Skip Navigation

University of Nebraska–Lincoln

AllergenOnline

Home of the farrp allergen protein database

Celiac Database search

Peptide Exact Match

Candidate proteins derived from members of the Pooideae subfamily of grasses would be screened as query sequences by comparison against the 1016 peptides using an EXACT MATCH algorithm. This is the primary screening tool and most likely to identify a protein representing a risk of eliciting CD.

Full Fasta

Candidate protein sequences may also be screened as query sequences against the set of 68 full length CD eliciting proteins using FASTA version 35.04. FASTA alignment results of greater than 45% overall identity covering at least one-half of the length of one or more of the 68 CD eliciting proteins, with an E score less than 1 x 10-15th (or 1e-015 in the tabular FASTA output) would represent a potential risk of eliciting CD. The matched protein should be screed further using biological systems such as a T cell stimulation test using proven CD-T cell clones or lines, or in vivo challenges.

Query protein sequence entry:

Please enter one or more search protein sequence below in FASTA format.

A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.


Example:

>gi|167018|gb|AAA32943.1| C-hordein storage protein [Hordeum vulgare]
FPQPQEPFPQQPQQPFPLQPQQPFPQQPQQPFPQPQ QPFRQQAELIIPQQPQQPFPLQPHQPYTQQTIWSMV

Sequence Entry
Search Options
  • Note: We do not observe or log any protein sequences submitted through this website.