Celiac Database search
Peptide Exact Match
The query sequence in compared with all 1016 peptides to locate any possible exact matches.
Full Fasta
The query sequence is run against the set of 68 full length proteins using FASTA version 35.04.
Our opinion is that proteins that do not contain an exact peptide match are unlikely to induce symptoms in those with celiac disease. A FASTA search of the query protein against the 68 proteins in the Celiac Database may also prove predictive, primarily as a negative screen. Query sequences that do not show any celiac peptide identical match and also have less than 45% overall identity to the 68 celiac inducing proteins in our celiac database are highly unlikely to elicit symptoms in those with celiac disease.
A FASTA comparison result of more than 45% identity over an alignment of greater than 50% of the length of one of the celiac eliciting proteins, with an E score smaller than 1 x 10-15th (or 1e-015 in the tabular FASTA output) would indicate potential risk that may require biological testing to demonstrate a lack of eliciting potential.
Please enter one or more search protein sequence below in FASTA format.
A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.
Example:
>gi|167018|gb|AAA32943.1| C-hordein storage protein [Hordeum vulgare]
FPQPQEPFPQQPQQPFPLQPQQPFPQQPQQPFPQPQ
QPFRQQAELIIPQQPQQPFPLQPHQPYTQQTIWSMV
- Note: We do not observe or log any protein sequences submitted through this website.
