Allergenic Protein Sequence Searches
Please enter one or more search protein sequence below in FASTA format.
A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.
For an explanation of the FASTA search algorithm (FASTA 35.04, 2009) please see the Support page.
Example:
>gi|378405189|sp|P86137.2|NLTP1_ACTDE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; Short=nsLTP1; AltName: Allergen=Act d 10.01
AVSCGQVDTALTPCLTYLTKGGTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARYQGIKDAAAAL
SQKCGVQLSVPISRSTDCSKIS
- Note: Sliding 80mer Searches Prior to Septermber 12, 2007 may have identified matches of exactly 35% identity. However to be consistant with Codex 2005 the calculation of the cutoff value for a match has been changed to Greater than 35%.
- Note 2: The sequences in the FASTA searchable database might vary from the sequences described in the public literature, as this database is not updated on a daily basis.
- Note 3: We do not observe or log any protein sequences submitted through this website.
